TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P47824|P2X1_RAT P2X PURINOCEPTOR 1 (ATP RECEPTOR) (P2X1) (PURINERGIC RECEPTOR) (RP-2 PROTEIN) - Rattus norvegicus (Rat).
MARRLQDELSAFFFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFVYEKGYQTSSDLISSVSVKLKGLAVTQLQGL
GPQVWDVADYVFPAHGDSSFVVMTNFIVTPQQTQGHCAENPEGGICQDDSGCTPGKAERKAQGIRTGNCVPFNGTVKTCE
IFGWCPVEVDDKIPSPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVNGTYMKKCLYHKIQHPLCPVFNLGYVVRESG
QDFRSLAEKGGVVGITIDWKCDLDWHVRHCKPIYQFHGLYGEKNLSPGFNFRFARHFVQNGTNRRHLFKVFGIHFDILVD
GKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYYKQKKFKYAEDMGPGEGEHDPVATSSTLGLQENMRTS