TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P48821|CECM_BOMMO MORICIN PRECURSOR (ANTIBACTERIAL PEPTIDE ENBOCIN) - Bombyx mori (Silk moth).
MNFTRIIFFLFVVVFATASGKPWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVASG