TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P49856|YKKC_BACSU Hypothetical 11.9 kDa protein IN HMP-PROB intergenic region - Bacillus subtilis.
MKWGLVVLAAVFEVVWVIGLKHADSALTWSGTAIGIIFSFYLLMKATHSLPVGTVYAVFTGLGTAGTVLSEIVLFHEPVG
WPKLLLIGVLLIGVIGLKLVTQDETEEKGGEA