TCDB is operated by the Saier Lab Bioinformatics Group
>P51802|CLCKB_RAT Chloride channel protein ClC-Kb - Rattus norvegicus (Rat).
MEEIVGLREGSPRKPVPLQELWRPCPRIRRNIQGSLEWLKERLFRVGEDWYFLVALGVLMALISYAMNFAIGRVVRAHKW
LYREIGDGHLLRYLSWTVYPVALLSFSSGFSQSITPSSGGSGIPEVKTILTGVILEDYLDIKNFGAKVVGLSCTLATGST
IFLGKLGPFVHLSVMIAAYLGRVRTKTVGEPENKTKEMELLAAGAAVGVATVFAAPISGVLFSIEVMSSHFSVWDYWRGF
FAATCGAFMFHLLAVFNSEQETITSIYKTSFPVDIPFDLPEIFFFVALGAICGILSCGYNYCQRTSLFFLKSNGFTSKLL
ATSKPLYSALAAVVLASITYPPGVGRFMASRLSMSEYLETLFDNNSWALMTKNSSPPWSAEPDPQNLWLEWCHPQMTVFG
TLVFFLVMKFWMLILATTIPIPAGYFLPIFVYGAAIGRLFGEVLSLAFPEGIVAGGKVSPIMPGAYALAGAAAFSGAVTH
TLSTALLAFEVSGQIVHALPVLMAVLAANAICQSYQPSFYDGTIIVKKLPYLPWIRGRKIGSHLVTVGHFMNCTLTTLAK
DMPLEEVIKVVISTDVTQYPLVETTESQVLVGIVKRTHLVQSLHTDSASWAPGQQPCLQDILANGCPTQPVTLQLSTETS
LHETHNLFELLNLQLLFVTSRGRAVGSVSWVELKKAISTLTNPPAPK