TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P52871|S6B2_YEAST Protein transport protein SEC61 beta 2 subunit - Saccharomyces cerevisiae (Baker's yeast).
MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLSVGFIFSVIALHL
LTKFTHII