TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P54163|YPDP_BACSU Uncharacterized protein ypdP OS=Bacillus subtilis (strain 168) GN=ypdP PE=4 SV=1
MFNNSFWIFFAIIHFIIVLLFYKGFGKMGLFVWIGFATVCANLQVVKTVELFGLTATLGNVMYGTIFFATDVLNEKYGPA
EARKAVWLGFSTLLTLTFVMQGVLLFEPASSDISQTALETIFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSDRLL
WLRNGGSTAVSQLFDTFIFTAVAFLGIYPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPNDERSS