TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P54281|ECLC_BOVIN EPITHELIAL CHLORIDE CHANNEL PROTEIN (CALCIUM-ACTIVATED CHLORIDE CHANNEL) - Bos taurus (Bovine).
MVPRLTVILFLTLHLLPGMKSSMVNLINNGYDGIVIAINPSVPEDEKLIQNIKEMVTEASTYLFHATKRRVYFRNVSILI
PMTWKSKSEYLMPKQESYDQAEVIVANPYLKHGDDPYTLQYGRCGEKGQYIHFTPNFLLTNNLPIYGSRGRAFVHEWAHL
RWGIFDEYNGDQPFYISRRNTIEATRCSTHITGTNVIVKCQGGSCITRPCRRDSQTGLYEAKCTFIPEKSQTARESIMFM
QSLHSVTEFCTEKTHNVEAPNLQNKMCNGKSTWDVIMNSTDFQNTSPMTEMNPPTQPTFSLLKSKQRVVCLVLDKSGSMS
SEDRLFRMNQAAELFLIQIIEKGSLVGMVTFDSVAEIRNNLTKITDDNVYENITANLPQEANGGTSICRGLKAGFQAIIQ
SQQSTSGSEIILLTDGEDNEIHSCIEEVKQSGVIIHTIALGPSAAKELETLSDMTGGHRFYANKDINGLTNAFSRISSRS
GSITQQTIQLESKALAITEKKWVNGTVPVDSTIGNDTFFVVTWTIKKPEILLQDPKGKKYKTSDFKEDKLNIHSARLRIP
GIAETGTWTYSLLNNHASPQILTVTVTTRARSPTTPPVTATAHMSQNTAHYPSPVIVYAQVSQGFLPVLGINVTAIIETE
DGHQVTLELWDNGAGADTVKNDGIYSRYFTDYRGNGRYSLKVHAEARNNTARLSLRQPQNKALYIPGYIENGKIILNPPR
PEVKDDLAKAEIEDFSRLTSGGSFTVSGAPPGNHPSVLPPNKIIDLEAKFKEDHIQLSWTAPANVLDKGKANSYIIRISK
SFLDLQKDFDNATLVNTSSLKPKEAGSDENFEFKPEPFRIENGTNFYIAVQAINEANLTSEVSNIAQAIKFIPMPEDSVP
ALGTKISAINLAIFALAMILSIV