TCDB is operated by the Saier Lab Bioinformatics Group
>P59632|AP3A_CVHSA Protein 3a - Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus).
MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFI
CNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPY
NSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDP
PNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL