TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P60059|S61G_HUMAN Protein transport protein SEC61 gamma subunit - Homo sapiens (Human).
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG