TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 OS=Bungarus multicinctus PE=1 SV=1
MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTC
CSTDKCNPHPKQRPG