TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P69808|PTFB1_ECOLI Fructose-like phosphotransferase enzyme IIB component 1 OS=Escherichia coli (strain K12) GN=fryB PE=3 SV=1
MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDV
YEITLQDAIKNAAGIIKEIEEMIASEQQ