TCDB is operated by the Saier Lab Bioinformatics Group
>P69937|SUGE_ECOLI Quaternary ammonium compound-resistance protein sugE - Escherichia coli.
MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYAVWTGIGAVGAAITGIVLLGE
SANPMRLASLALIVLGIIGLKLSTH