TCDB is operated by the Saier Lab Bioinformatics Group
>tr|P73520|P73520_SYNY3 Sll1352 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1352 PE=4 SV=1
MEVSQSKPEGFLPPRSLLVGMAIGAVILFICATVRHWLFQSTALDLGFFDQAIYLISQGEYPRVSFRGFHILGDHAAFLV
YPIAIFYKIYPSVYWLFLIQAIALALGAWPTWQLAKQTGLGEKESLTMALVYGLYPLIFNINLFDFHTEVIAVPALLWAV
WSARANKWGIFLISLVTILASKAVLSLTVFMLGIWLLIWERKRLMGLITTVAGIAWFIITTKGIIPAFSGEEAAAVGRYS
FLGDSVAEIILNLILKPQIVLGMLFTLDNLFYLVLLTAPVIWGIWGKAWAMFIPAIPALFVNLVTDYLPQKDLIHQYSLP
ILPFLLLVVMTHWYQGSSWLKKLRWIILWTAIAFLALGKYTYFFGRYWHHWGQLANLQTAVSLVQPGDRVLTSPHLAAHL
SHRPDLELAIEAEAPFDLNRFDAVLLQTNYAGWENSQGTVEALAQRVSQDSAFTPEYQENEVILYRRAPSIP