TCDB is operated by the Saier Lab Bioinformatics Group
>P74477|P74477_SYNY3 Chloride channel protein - Synechocystis sp. (strain PCC 6803).
MAWFPFWQRWQQWLRSRHYGRTAIDSRYAIAEACVIGFVSALAALVIKNGVNWLGSSRLSLADTYGAIWVLPCFGLVFGG
LAGALIEQFSRPAGGGGIPQVKAALARYPIPLDWRVAVVKLLGTVLVLGGGMTLGRRAPTVHIGAALAAQLSRWFPTSPE
HRRQMIAAGAAAGLAAGFTTPIAGVLFVVEELMRDVSSLTLETAIVASFVGAVTSLVFQSSDLNLAHSLSNSPTVRFTTG
EIPFYLLLGILAGILGVLLNRSILSLQNWQRKQNLSLVIRIGVVGLISGVAIALLPSFFRDNAGLREFVTSGELSWHQVV
LTLVAHFILTILAYSTDAPGGLFAPALVMGSALGYLVGEFGSYWQDQVTQTTFALAGMGAFFTSVVRVPVTAIIIVFELT
GNFNVVLPLMVACATSYLVAESLFPRSLYDHLLETKGIFLAEEKPDHDFLADIRAGQVMKTEVESLEQSLTLAQVLPIMS
NSHHRGFPVVQGGKLVGVFTQTDLANAAQESVHIALKQIMTPNPITVDPEAPLSDVLYLLNRYQLSRLPVVEGDNKLVGI
ITRTDIIREEVSQLGGQIIHPPHPAYSVYQTRSPLVGEGRILLPIRDSDSALVLFQIAAAIAKKQNYEIDCLQVVKVSKA
QSPSVQRVQWQRQRQLMQKLERIARHQRVLFHTEIKLAYSITDTILDTIQTRHSDLLILEWQGEMPIGGQIFGQITDRLI
DQAPCSLLMVKQGTNDHAYPRYLSPMAHWLMPVAGGPNIEKMLNLLPALFSLYPEENNPQLLISKVYLPRQSQRYDPFYD
LKNLAERWSEQLQRPIIPIPVCSTSIADALSDLAEMRECAAIVLGASREGLLKNVIHGNLPTQIASQTNTTVFIFRGPVD
SPNEEAIVPPLAPDFGLDE