TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P76481|YFBK_ECOLI Uncharacterized protein yfbK OS=Escherichia coli (strain K12) GN=yfbK PE=4 SV=1
MRNKNIIMLLMSSLILSGCGPQPENKESQQQQPSTPTEQQVLAAQQAAIKEAEQSAAAAKALAQQEVQQYSDKQALQGRL
QEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNPLATFSLDVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYF
PSDWDIKDKQSIPASKPIPFAMRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLIDTSGSMISDERLPLIQSSL
KLLVKELREQDNIAIVTYAGDSRIALPSISGSHKAEINAAIDSLDAEGSTNGGAGLELAYQQATKGFIKGGINRILLATD
GDFNVGIDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEAMMVRIADVGNGNYSYIDTLSEAQKVLNSEMRQMLITVAKD
VKAQIEFNPAWVTEYRQIGYEKRQLRVEHFNNDNVDAGDIGAGKHITLLFELTLNGQKASIDKLRYAPDNKLAKSDKTKE
LAWLKIRWKYPQGKESQLVEFPLGPTINAPSEDMRFRAAVAAYGQKLRGSEYLNNTSWQQIKQWAQQAKGEDPQGYRAEF
IRLIELADGVTDISQ