TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P81007|ENT_ENTCO Cytolytic protein enterolobin - Enterolobium contortisiliquum.
TQRDTLTKGMTQGQIVAGPDDTKIDQSIMDQGVCATIALPFDIHVAQSVKNVMFMFAWTQKHGLAVNNLVILGVPGYLNM
WKRFGESTDEPSESSKRCCYEKPTDPVSGEIVTPAFDPADEISEITHQEESADIKPVRLLDARLLGYTWVTQNHSWIVAY
SDEPIKDGNEVVTLRNIGNNNFCDALRKCTDKSACIHQYLQFAWNSFGDPTVRTRQVVFEVVGWADSDTTNNNSDTLFYR
TTQADNWQVLTESKTNTIGLAEVDWFNFKYETKQEVSIEIARQTWTSTLNAGVSTVSRVPKVPIKVKINVDTFLKVLFAV
YKADLYDIFLQFASVFKKGGNRQYWLNYTQEPNTKSNYNHKIYNDKIRYLQEDVQVHPNETQSKWWWWSFKKVALTTMTV
VALTRFKASGINGQYISARQFSGGETVSPYRLAAPFDSCLWRRSPNPLGTDGLKVALAHHPLAGASNRNKLRVSIPAQCI
CSITA