TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P81450|ATP18_YEAST ATP synthase subunit J, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP18 PE=1 SV=1
MLKRFPTPILKVYWPFFVAGAAVYYGMSKAADLSSNTKEFINDPRNPRFAKGGKFVEVD