TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P81891|ARNE_SALTI Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE OS=Salmonella typhi GN=arnE PE=3 SV=2
MIGIVLVLASLLSVGGQLCQKQATRPLTTGGRRRHLMLWLGLALICMGAAMVLWLLVLQTLPVGIAYPMLSLNFVWVTLA
AWKIWHEQVLPRHWLGVALIISGIIILGSAA