TCDB is operated by the Saier Lab Bioinformatics Group
>P82270|RTD1A_MACMU Rhesus theta defensin-1/3, subunit A - Macaca mulatta (Rhesus macaque).
MRTFALLTAMLLLVALHAQAEARQARADEAAAQQQPGTDDQGMAHSFTWPENAALPLSESAKGLRCICTRGFCRLL