TCDB is operated by the Saier Lab Bioinformatics Group
>PHT57019.1 hypothetical protein CQW23_05505 [Capsicum baccatum]
MREISKNSGSGSGSSFWTWKSPLPYLFGSLGLMLLLIVVALIVLACSFHKRLSSSDQQIKSACPPVNSTVVEMSPRIVVI
MAGDQKPTHIGVPISSDKTHTAV