TCDB is operated by the Saier Lab Bioinformatics Group
>PHX65583.1 hypothetical protein CK550_04200 [Gemmatimonadetes bacterium]
MRRALIDWSRLAPAAPLLSSVALLALTLLAMHWSAQSLARQSSQLFGRRLQLYLFGLPGTIVHEGSHVIACVLFRHRVHR
VKWFDPSATDGALGSVEHSYDPSSAYQRVGTIVIGLAPLLAGAAVLLLAARLLLGVPLVPLADLTQVAAWRWTLFAYVSL
SVGGSMHLSASDVRGTWRGVVTLGVWIAAALLLSLAVWWALLQLAPTVWPAHVAPLLRQAATSVARASDVLSGALQLSVV
VNVAGTVLLFVVRRLVRVVR