TCDB is operated by the Saier Lab Bioinformatics Group
>PIN02799.1 hypothetical protein CDL12_24683 [Handroanthus impetiginosus]
MSELNGGRAKAWNIYSSSSSNGSADVNHPWKSFGTSMDAISFGFVATAILISMFLIMAIFEHLFRPNASSHDDSGGMESR
QLRKLGNPDTVQTSSYASDFSVVMPGQQYPTFIAQPAPLKLPSCHREGVIYWPSHSHIV