TCDB is operated by the Saier Lab Bioinformatics Group
>PIS09479.1 hypothetical protein COT75_01260 [Candidatus Beckwithbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_34_10]
MKRKIGDLTRVISTIISRIFDPIWESLIILFLLSQLAKSEFPKGSLFLLSFFLVYLIPWLFFHYQLKKGKISDWDITKRE
ERISFYSVSKVTILIFFSILFFLSPKSIPFYLKFLIPFLIFYLLTFFNKVSGHMITNTLFILSIYFYTGKSDILYIGIII
LLLVALSRFNLKKHTLPQLIIGTGLGLLALI