TCDB is operated by the Saier Lab Bioinformatics Group
>PKK83642.1 hypothetical protein CVT49_07755 [candidate division Zixibacteria bacterium HGW-Zixibacteria-1]
MRETASYISARHILAYLMFAGTLLDFAFWVVYFGGAGLSGETNRQVISVYESAFPYADILIGFILMVGGIGLIRCKHYGK
LCLLIASSMAVYLGIIDITFYIRQGLYLPLSISSIFELFINAACVLGGTAGLLIACRLLRENNKYSSEDKPRTTAEDNHP
AYICSLSFLRLYVITMRPYLFFVSGIAGIAGLALSELTSLASGIMYAVIFLLSYGFGQALTDSMQVDTDSLSSPYRPLVQ
GKIRRRDVAIVSLGGLFLSGFLLILASWINIVLCTLAIIGLASYTYIKRRWWAGPFYNAWIVALLCLIGFVSGNGSASES
NIISPALLLTVLAVFFAYANFVLTGYYKDISADRTTGYLTMPVVFGFNISAIVSDIFAITAIISTALTLYYIYEDIASLK
EILPPLILILAGLTMSITAQRRLHQVIDEKKAYRAITPVVHSFILMLSAITTAARPNWTISIIILYAAFVFTLWLRPMKE
QI