TCDB is operated by the Saier Lab Bioinformatics Group
>PRP88798.1 P2X receptor [Planoprotostelium fungivorum]
MHIKKPDSLWDSLLIYTTVKVVKIRDWRLGVLHYAFMLGILGYVAVYAVWLNKGYLQKDQPVGSVRSTLAPPDQLNATNT
FPYCSQYQPAYQGFNNFPCIYYSGHDVQMPDALANPFMIVTRTKSFTLNGSPNINCTGRFIDQPECIITNKQTKDPTAGT
TQRYYTAGIEDYTLFMEHVVYGRSSHFSGRNEDMEERFYDSKGDLMTIDTNTGDIITVRQLLSMAGITSLDTISSISNHT
ARYDGVQIMVIIDYQSEILNSNKYTYTVRASQIIGVDTTVTTSTQDGSVVTYNGIIVSYIQTGTIGVFSFPALLTSIIGG
AVLTGVATTVVDLMAVYLMPEKEWYSEKKFDDSLARPERNTISLPELEEPLLY