TCDB is operated by the Saier Lab Bioinformatics Group
>PYK96039.1 hypothetical protein DME32_18515 [Verrucomicrobia bacterium]
MRGQATEPFRRKMLFLPRPLKIAAVCAALMLILFSRRPEMFLHPEFWAEDGWIFFVQADTQGADALLTPYGGYHHFLLRI
IAAAAAGLDARWIPVAYISANLLTVANLQWLSALGLVWLLVARDPLNKRQYATDGLLAGVIGLTGIFSILLTPLFVWRAW
RRKTQPSMFLASVVAITAAIQIWTLLCSADDSSSGAWPPLEAIACLVGYRLPASLFFPMSFAVQLSRAALDGLGVLFVGL
LIAAAAWKGRGQNIRGLLVAVIILLIAATIFRSRSHLWAFGSLADGDRYFFLPKLLTAWLLISGWSVPGLFRGAATATCG
LGLLASAVDWHYEPLADHNWPEYARRIEAGEALSHIPVNPKGRSFDHPGRHRKEPLQMRSDNT