TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q00319|P47B_CANBO Peroxisomal membrane protein PMP47B - Candida boidinii (Yeast).
MSSREYDDLSHAFAGAGGGLLSMTLTYPLVTLTTHAQTMVRLKKNEEEEKENSNEDGSLSPKSSNTSNISQKKISQFEIL
KKILKDQGAKGLYNGLESALFGIAVTNFVYYYFYELTGKTLSRRSNPQTTSGSKKVTLKKGLSVWQSMAAGAVAGTISRV
ATNPIWVANTRMTILSKNQGKLGKLNTIEAIIYILKNEGWQKLFTGIVPALFLVLNPIIQYTIFEQLKSFIVKIKKRNVT
PVDALLLGAFGKLIATIITYPYITLRSRMHVKSMTENNEDSEKERTDSVQSLPEDGSDEDNSKENPYAETINKIISKLPS
PIVSMFIIGYKMYKEEGVSSFYRGLSVKLLQSILNAAFLFYFKEELLILSDAIIKSTKRVTGLANNPYNAKDVIHSFEKA
LCMRNPRSRTTTVPQTNEE