TCDB is operated by the Saier Lab Bioinformatics Group
>Q01469|FABPE_HUMAN Fatty acid-binding protein, epidermal - Homo sapiens (Human).
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADG
RKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE