TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q03708|IMM7_ECOLX Colicin-E7 immunity protein OS=Escherichia coli GN=imm PE=1 SV=2
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANG
KPGFKQG