TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q03RG7|Q03RG7_LACBA Uncharacterized protein OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=LVIS_1073 PE=4 SV=1
MNEFTKIIKLLNDTGILGVLIFALVGWFTRINPALKTKIAANKSATQREVLSMLDTLAFSAVNKAATNYEMPGEEKREQA
IADVTGQMKVFGHDSLAPAIISAAIEKAYQSMTTTDTKAQSKQVEYNAALADTEQAFADKQAQLDKQAATVPADPAPLNV
PEGTATTEGDAK