TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q058P6|CLT1_ARATH Protein CLT1, chloroplastic OS=Arabidopsis thaliana GN=CLT1 PE=2 SV=1
MATTSSDRLIAGLTASIGSIESRYANPAQSVSLICRNQINGAPPIVLRSSRRSRLWLIEAIPPAKSWNGSNDGDEDIKKS
DTRNYAIGGTGGHAVAGKDDRTMEIVIAAATTAALGVGNRVLYKLALIPLKQYPFFLAQLSTFGYVAVYFSILYFRYRAG
IVTKEMLSVPKLPFLIVGVLESLALAAGMAAASNLSGPSTTVLSQTFLVWQILFSIIFLGRRYRINQILGCTLVAFGVIV
SVASGSGAAHSFKDTGILWSLLMVFSFLLQGADTVMKEVIFLDSKKRLKGASLDLFVVNSYGSIFQVICIALLLPFLSKL
WGIPFNQLPSYIRDGGACFLNIGSRITGCEGAPLLPVMFVMMNMAYNISLLRLIKISSAVVSSLASTVSVPIAVYCFTLP
LPYLGVASTLPRGFVAGTIILVVGMLLYAWTPSTNTSDSIIPSPPST