TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q06686|CTR3_YEAST COPPER TRANSPORT PROTEIN CTR3 (COPPER TRANSPORTER 3) - Saccharomyces cerevisiae (Baker's yeast).
MNMGGSSSTAAKKATCKISMLWNWYTIDTCFIARSWRNDTKGKFAGSCIGCFALVVVAQWLTRFSRQFDVELLKRQKIKH
LASYSPEEYVVKCGEEDAKSDIEELQGFYNEPSWKTTLISLQKSFIYSFYVWGPRRLNEPEDDLLKKVLSCCTLITPVDL
YPTFLDHMIRVTIFVLQWGLSYIIMLLFMYYNGYIIISCLIGAIVGRFIFCYEPLGSLGANGSAQGTVSYDKESDDRKCC
L