TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q07831|PFPN_ENTHI NONPATHOGENIC PORE-FORMING PEPTIDE PRECURSOR (APNP) - Entamoeba histolytica.
MKAIVFVLIFAVAFAVTLRQGPIVCNLCTGLINTLENLLTTKGADKVKDYIDSLCNKASGFIATLCTKVLDFGVDKLIQL
IEDKVDANAICAKIHAC