TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q07A30|Q07A30_ASTSI Nodule-specific protein OS=Astragalus sinicus OX=47065 PE=2 SV=1
MTKSVKCISTLILFFFLFLHVTNGCQFSQNNLTLRDKDVEVRMRPGEGTRKMYPSTYSCGGHIDCKDFCKSEGYRGFKCT
PKKTCTCFHI