TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q08580|PEX27_YEAST Peroxisomal membrane protein PEX27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX27 PE=1 SV=1
MTSDPVNTNISSPTLTDRNADESWELLKREFNTLFSNLKTDSKEEGNFTDNKGVIAKKPIVLQDNDDSDFTQNQGKVATA
TSTTSDRSFKRTLGSIEMKKRYVKKNCQAKFVFNTLEGKEVCSKILQHTLGLLSLLLLTRKIRLLNFSSKLRLVIQQLSL
FRYYLRFGNFAINLYKIIKRFRWLREMKKLHYKDQSILFYFKNFRFFDIIEAFYNLTDELILFHKLQSMFGKKNTSHANT
NRLMTFVKEQHYILWEVLNILAINKNIEQWRQLIRDEIYLSIYNTSGNAIKEYELKYKLPTNDKVNLELRKNNITLDFYK
IILNLLSNLINIKGKRDKYNSELAYEIISVGSGVTELLKLWNRAKVTSANEHTSAV