TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q09906|TM184_SCHPO Transmembrane protein 184 homolog C30D11.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC30D11.06c PE=1 SV=1
MDNEIVALCGFFVAIALVLSCISIITHLKNYKKPVLQRSVVRILMMIVIYSSVSFLSVYNEKIGSIFEPFREIYEAFALY
CFFCLLIDYLGGERAAVISLHGHLPRPRLWPLNYLQDDIDLSDPYTFLSIKRGILQYTWLKPFLVIAVLLTKVTGVYDRE
DQPVYASADLWIGLVYNISITLSLYSLTTFWVCLHEELAPFRPFPKFLSVKAIIFASYWQQTVLSITNWLGLLNGTGWIY
SLLNQNVLMCLEMPFFALSHWYAFRIEDYDTPTWLSCARLPLLKAFKDVIGLKDVWCDSLQTLHGDRYVYQNFEPGENLI
PSRNDGRINRTSHGLRYSQGGQSKYWISRYDQSRVRLINNSQNSPQSNKSYFSIPGMSTSHFENGLQFEIDDEMEPLYNQ
AKQMRYGDYNYPVLLVNNTHASSSYT