TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q0S1M9|Q0S1M9_RHOSR Phosphoenolpyruvate--protein phosphotransferase OS=Rhodococcus sp. (strain RHA1) GN=RHA1_ro06785 PE=3 SV=1
MTENREIVRGTPVVPGIAYAPVIWPAPRPEVASGSARIDEVSRDAEKVRFEEAAAVVSQRLRDRAASVSGAAAEVLQANA
AMAADRGWLGAAQKLIAGGTPAEEAAAEATEQFATLFTKMGGLMAERVTDLRDIRDRVVSELLGLSEPGIPVPSTPSILC
AQDLAPADTAGLDPELIVGLVTVLGGPTSHTAIISRQLGIPCVVAVRDLESVVAGTPVLLDGSAGELVVEPDPVEARAAV
EHGRAERIRIQSWEGPGRTSDGHSVSILANVQDGAGARSAATTAAEGVGLFRTELCFLDRDSEPGVDEQAEIYGEVLDAF
AGRKVVIRTLDAGSDKPLRFANHAEEANPALGVRGIRIAEQNPGILSRQLDAVAAAAKQTQSQPWVMAPMISTPAEAESF
AAEVRARGLVPGVMVEVPAAALLADRLLRHVDFLSIGTNDLAQYTMAADRMSSDLASLTDPWQPAVLALVARTAEAGIAA
GKPVGVCGEAAADPLLACVLIGLGVTSLSCAGAAVSGVGAKVGSVSLDDCRRAAEDVLATSDPAEARAAAVRVLGA