TCDB is operated by the Saier Lab Bioinformatics Group
>Q12375|ORT1_YEAST Mitochondrial ornithine carrier protein - Saccharomyces cerevisiae (Baker's yeast).
MEDSKKKGLIEGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIASPLVGA
CLENATLFVSYNQCSKFLEKHTNVFPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAII
TERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSV
MQTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFETLSAL