TCDB is operated by the Saier Lab Bioinformatics Group
>Q12983|BNIP3_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 - Homo sapiens (Human).
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAS
ETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAE
FLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF