TCDB is operated by the Saier Lab Bioinformatics Group
>Q14P12 Conserved hypothetical transmembrane protein
MQTKIKDLFYLDTKRVVAMAIVIALYVLLSWLSKIMNLTVFPVASFLKIELTDFLMLLALRLFGIIYATFLTISVSWLRI
VYLADTPIAVFALMLSDLIFLLVFWLGDNFFRKGINRLFKNNFSKKTDYLITTINVGLATITVSFVMALFNWLFIYDMYA
HFLNLSREIVQGFKSILVPIIIPFNLLKFTINSIVFILIYRAVIHLQKQFIIIKPRKEVTEALHDYNIIDEIYF