TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1CUX7|Q1CUX7_HELPH Uncharacterized protein OS=Helicobacter pylori (strain HPAG1) GN=HPAG1_0178 PE=4 SV=1
MNYIDLALLVVVVAFGIRGFYHGFVSEVAGTLGIVLGVYLASRYSVAVGNLFSEHLYDLRNETMTNLIGFLLVLASIWVF
FLAFGVLLGKVLVFSGLGIIDKALGFIFSCLKTFLVLSFILYALSKMEVMKDANAYLQEKSAFFSTMKSIASKIMRLDGV
KHVEQNLKGNLEEMSDEVKNKESFNKNKESFNKTMDKGVESLKEKAKDLPKNMLDPKANQTPPNPTPSNKEPL