TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1MIM3|Q1MIM3_RHIL3 Putative transmembrane protein OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL1692 PE=4 SV=1
MKDMNQTSLAVEPSRAVVGALWMVLAGIAFSLLNVVTQWLTMKLAFPSASAAFWQYGFAFLFSLPFLKRLGLAAMRTHYP
WRHLTRVVLAALGVEAWVAGLAAVPIWQAIALVMTSPFFIILGARLFLGERVGPARWAATAAGFTGAMIILQPWSDGIGW
AALLPVLSALLWGASSLITKSLTGIERPETITVWLLVLLTPINGGLALAAGFAVPTGATLALFLLAGLLTAVAQYFLTLA
YAAADAAYVQPFDDLKLPLNVLAGWLFFGYAPAGYLWLGAALILSASLFIMRNEMRRERKPA