TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1MQG2|Q1MQG2_LAWIP Uncharacterized membrane protein, required for colicin V production OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=LI0711 PE=4 SV=1
MNLLYQLNILDLVLVILCIFFILKGLNRGLLQELAGIIIFIISLWTAYMLYIKFGNMLLSYIGSQKWSYFLAYIAIFFSV
MIISSIMSGLLQKHLGWKSGGWINWLGGGVIGALKAFVFCMIIIAVFEYTADSKPFVLESKIVTFVKKHDTFFREFIKHS
IGNERSI