TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q1RDE6|Q1RDE6_ECOUT Uncharacterized protein OS=Escherichia coli (strain UTI89 / UPEC) GN=UTI89_C1135 PE=4 SV=1
MTFRYYLRHCLWGLVGCGSLVYNILTDLKDGKIFPSYVPYIPYVAAYLAIGAVAYPFAYYALEISAQKIIPKKSWDRFFS
DTGSSRNLFLFVLMFCILFIVPLLALYFCISKKHNELQT