TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q21973|YXAK_CAEEL Hypothetical protein R13.3 in chromosome IV - Caenorhabditis elegans.
MTVNYNLDVSSASIFSFLRLQLRWKGSIWKYLLKELFMFIIAFITVSSVYRSNLIIGEKTRKIWDNFAALFDQNMDFIPL
TFMLGFFVTIIVRRWNDIFANLGWVENTAITVANYIRGTDDRTRMIRRNVIRYMVLAQVLVFRDCSIQVRKRFPTMESIV
SAGFMLEHEKEALDNVQCGKLQKYFVPIQWSTGLLVDARAEGKIAADLLMNEIGKHIIEFRKMLALLSNYDWVPIPLAYP
QVVFLAVRSYFFMALIARQSVLLDGKEPEQPSILYPTVPFVMSILQFIFVVGWMKVAESMINPLGEDDDDFECNYLLDRN
LMIGLCIVDDNYNRTPSVEKDAFWCADVEPLYSVETAMIPKNPQIGSAANYDVKVDEEEVMMMPHMDDVDLFDFESTNNL
IPRKTFSVISIQRPFGSRASLASRKRSMMFDQLRGRIAKKQHRSNMFQNSVSQASLHYFESQAPSEINLSTLEMTAPKRK
SSTGKLGSMNVAEEQHKLSAEVLPIVIEEDEERSKMLEKDKNKNA