TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q24824|PFPB_ENTHI PORE-FORMING PEPTIDE AMEOBAPORE B PRECURSOR (EH-APP) - Entamoeba histolytica.
MRAIIFVLIFAIAFAATREGAILCNLCKDTVKLVENLLTVDGAQAVRQYIDNLCGKASGFLGTLCEKILSFGVDELVKLI
ENHVDPVVVCEKIHAC