TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q24825|PFPC_ENTHI PORE-FORMING PEPTIDE AMEOBAPORE C PRECURSOR (EH-APP) - Entamoeba histolytica.
MKLFVLLCVFVLCLASQEKQQDREIPVLCPVCTSLVGKLIDLVLGGAVDKVTDYLETLCAKADGLVETLCTKIVSYGIDK
LIEKILEGGSAKLICGLIHAC