TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q2VNY0|Q2VNY0_ECOLX Colicin Ib immunity protein OS=Escherichia coli GN=imm PE=4 SV=1
MKLDISVKYLLKSLIPSLIILTVFYLGWKDNQENARMFYAFIGCIISAITFPFSMRIIQKMVIRFTGKEFWQKDFFTNPV
GGSLTAIFELFCFVISVPVVAIYLIFIFCKRRRNQQQPVQLPHRYGS