TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q2WFL8|SHSA2_XENLA Protein shisa-2 OS=Xenopus laevis OX=8355 GN=shisa2 PE=1 SV=1
MWLEGSPLAVLAAVSFLLSVLAAAQGSGEYCHGWLDAQAVWRDGFQCPERFDGDDSTICCGKCELRYCCSSAEARLDQGV
CNNDRQQGAPDHNRPDKDSPDSTAVPIYVPFLIVGSVFVAFIIVGSLVAICCCRCLRPKQEPQQSRAPGSNRLMETIPMI
SSASTSRGSSSRQSSTAASSSSSANSGARPPPTRSQTNCCLPEGAMNNVYVNMPTNFSVLNCQQATQLVQHQGQYLHPQF
VGYAVPHDSVPMTPVPQFIDGLQGGYRQMQSPYPHSNPEQMMYPAVTV