TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q38XE8|Q38XE8_LACSS Hypothetical integral membrane protein OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=LSA0829 PE=4 SV=1
MKKFKTRHLTIIALAIALNYVGSNIALVLRLPIYLDSIGTILAGALLGPLAGALTATASSVLSGITTDLFALYYLPDGLL
TGLLAGWFLYQHQRSKREIPLVAIGVALPGTVVSSLITYFLFHGITSSGSSMIVQLLSGLGLNQFASITLVQAGTDYLDR
LLAIVIVTQVCYHLKKQIATL